PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013622401.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 421aa    MW: 46672.6 Da    PI: 6.9688
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013622401.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.39.4e-10276331560
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                     kr +r   NR +A rs +RK  +i eLe kv++L++e ++L  +   l+  +  l+
  XP_013622401.1 276 KRVKRILANRQSAARSKERKMRYIVELEHKVQTLQTEATTLSAQFTLLQRDMMGLT 331
                     899**************************************999888877666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.5E-17272336IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.415274337IPR004827Basic-leucine zipper domain
PfamPF001701.6E-8276324IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.29E-11276332No hitNo description
Gene3DG3DSA:1.20.5.1701.7E-11276331No hitNo description
CDDcd147032.08E-22277326No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MGDTDTDMIH RLHSPFGKQP KQLQLNPKPP TSPYSQIQNL NPVGATTSHS RSMSQPSSFF  60
SFDSLPPLSP SPFNNNNNNN PSSSLLPPSP FTRCNSDSSR VVLLPPRKSH RRSNSDISGG  120
ESADWSTKTT PPFVKKESGE REDMDDLFSA YMNLENIDDM ESSRASGTKT NGSDDTEGES  180
SSVNYESGGD RNNSLKRRAG AGGGDIAPTS RHYRSVSVDD SCFMEKMSFG EDSLKPPPTN  240
SVNGGIEFKS GEFNAAEMKK IMANDKLAEM AVSDPKRVKR ILANRQSAAR SKERKMRYIV  300
ELEHKVQTLQ TEATTLSAQF TLLQRDMMGL TNHNNELKFR LQAMEQQAQL RDALSEALNG  360
EVQRLKLAIG ETSHNESDRS KMQSLNAEMF QQLNISQLTQ QRQSQQNQNG TLSAKPESNE  420
L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0808391e-163AY080839.1 Arabidopsis thaliana unknown protein (At4g38900) mRNA, complete cds.
GenBankAY1504351e-163AY150435.1 Arabidopsis thaliana unknown protein (At4g38900) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013622401.10.0PREDICTED: transcription factor RF2b-like
RefseqXP_013622402.10.0PREDICTED: transcription factor RF2b-like
RefseqXP_013622403.10.0PREDICTED: transcription factor RF2b-like
RefseqXP_013622404.10.0PREDICTED: transcription factor RF2b-like
TrEMBLA0A0D3BJA60.0A0A0D3BJA6_BRAOL; Uncharacterized protein
STRINGBra010722.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-162bZIP family protein